Streptavidin

IBA Lifescience Kontakt z doradcą
Efficient immobilization of biotinylated analytes

Streptavidin is a tetrameric protein composed of identic subunits. Each subunit specifically binds one biotin molecule with fM affinity, which makes it one of the strongest non-covalent interactions known. The preparation contains an N- and C-terminal shortened variant (core streptavidin) with improved properties regarding homogeneity, solubility, resistance towards proteolytic degradation, and accessibility of the biotin binding pocket as compared to native streptavidin. The streptavidin:biotin system is widely used for immobilization and detection of biotinylated molecules, like proteins and nucleic acids.

IBA Lifesciences provides bulk amounts of lyophilized streptavidin in reliable and high quality at competitive prices to generate streptavidin-coated surfaces (microplates, SPR chips, beads) or detection reagents conjugated with, e.g., fluorescent dyes. Please note that streptavidin is not applicable for detection, immobilization, and purification of Strep-tag®II and Twin-Strep-tag® fusion proteins, since the binding affinity for both tags is too low.

Specifications

  • Form: Lyophilized powder
  • Possible Application: Coating of surfaces
  • Purity: > 95%
  • Reconstitution: Water
  • Sequence: MEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS
  • Size: 13.3 kDa per subunit
  • Source: Recombinant, expression in E. Coli
  • Specific Activity: > 17 U/mg

Podobne produkty

pESG-IBA123 vector

pESG-IBA123 vector

IBA Lifescience
Więcej
Magnetic Separator

Magnetic Separator

IBA Lifescience
Więcej
pLSG-IBA3 vector

pLSG-IBA3 vector

IBA Lifescience
Więcej